Big dynorphin (English Wikipedia)

Analysis of information sources in references of the Wikipedia article "Big dynorphin" in English language version.

refsWebsite

Global rank English rank

9nih.gov

4^th place

7doi.org

2^nd place

3worldcat.org

5^th place

2guidetopharmacology.org

low place

1semanticscholar.org

11^th place

8^th place

1nature.com

234^th place

397^th place

1elsevier.com

610^th place

704^th place

doi.org

Kuzmin, Alexander; Madjid, Nather; Terenius, Lars; Ogren, Sven Ove; Bakalkin, Georgy (2005). "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology. 31 (9): 1928–1937. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
Tan-No K, Esashi A, Nakagawasai O, et al. (2002). "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. doi:10.1016/S0006-8993(02)03180-3. PMID 12363399. S2CID 1734522.
Merg F, Filliol D, Usynin I, et al. (2006). "Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor". J. Neurochem. 97 (1): 292–301. doi:10.1111/j.1471-4159.2006.03732.x. PMID 16515546.
Lai, Josephine; Luo, Miaw-Chyi; Chen, Qingmin; Ma, Shouwu; Gardell, Luis R.; Ossipov, Michael H.; Porreca, Frank (1982-01-22). "Dynorphin A activates bradykinin receptors to maintain neuropathic pain". Nature Neuroscience. 9 (12): 1534–1540. doi:10.1038/nn1804. ISSN 1546-1726. PMID 17115041.
Kanemitsu, Yoshio; Hosoi, Masako; Zhu, Ping Jun; Weight, Forrest F; Peoples, Robert W; McLaughlin, Joseph S; Zhang, Li (November 2003). "Dynorphin A inhibits NMDA receptors through a pH-dependent mechanism". Molecular and Cellular Neuroscience. 24 (3): 525–537. doi:10.1016/S1044-7431(03)00214-8. PMID 14664805.
Vanderah, Todd W.; Gardell, Luis R.; Burgess, Shannon E.; Ibrahim, Mohab; Dogrul, Ahmet; Zhong, Cheng-Min; Zhang, En-Tan; Malan, T. Philip; Ossipov, Michael H.; Lai, Josephine; Porreca, Frank (2000-09-15). "Dynorphin Promotes Abnormal Pain and Spinal Opioid Antinociceptive Tolerance". The Journal of Neuroscience. 20 (18): 7074–7079. doi:10.1523/JNEUROSCI.20-18-07074.2000. ISSN 0270-6474. PMC 6772839. PMID 10995854.
Bruchas, M.R.; Land, B.B.; Chavkin, C. (February 2010). "The dynorphin/kappa opioid system as a modulator of stress-induced and pro-addictive behaviors". Brain Research. 1314: 44–55. doi:10.1016/j.brainres.2009.08.062. PMC 2819621. PMID 19716811.

elsevier.com

linkinghub.elsevier.com

Kanemitsu, Yoshio; Hosoi, Masako; Zhu, Ping Jun; Weight, Forrest F; Peoples, Robert W; McLaughlin, Joseph S; Zhang, Li (November 2003). "Dynorphin A inhibits NMDA receptors through a pH-dependent mechanism". Molecular and Cellular Neuroscience. 24 (3): 525–537. doi:10.1016/S1044-7431(03)00214-8. PMID 14664805.

guidetopharmacology.org

"Big dynorphin: Biological activity". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Principal endogenous agonists at κ receptor
"Big dynorphin: Structure – Peptide Sequence". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Peptide sequence
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr

nature.com

Lai, Josephine; Luo, Miaw-Chyi; Chen, Qingmin; Ma, Shouwu; Gardell, Luis R.; Ossipov, Michael H.; Porreca, Frank (1982-01-22). "Dynorphin A activates bradykinin receptors to maintain neuropathic pain". Nature Neuroscience. 9 (12): 1534–1540. doi:10.1038/nn1804. ISSN 1546-1726. PMID 17115041.

nih.gov

pubmed.ncbi.nlm.nih.gov

Kuzmin, Alexander; Madjid, Nather; Terenius, Lars; Ogren, Sven Ove; Bakalkin, Georgy (2005). "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology. 31 (9): 1928–1937. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
Tan-No K, Esashi A, Nakagawasai O, et al. (2002). "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. doi:10.1016/S0006-8993(02)03180-3. PMID 12363399. S2CID 1734522.
Merg F, Filliol D, Usynin I, et al. (2006). "Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor". J. Neurochem. 97 (1): 292–301. doi:10.1111/j.1471-4159.2006.03732.x. PMID 16515546.
Lai, Josephine; Luo, Miaw-Chyi; Chen, Qingmin; Ma, Shouwu; Gardell, Luis R.; Ossipov, Michael H.; Porreca, Frank (1982-01-22). "Dynorphin A activates bradykinin receptors to maintain neuropathic pain". Nature Neuroscience. 9 (12): 1534–1540. doi:10.1038/nn1804. ISSN 1546-1726. PMID 17115041.
Kanemitsu, Yoshio; Hosoi, Masako; Zhu, Ping Jun; Weight, Forrest F; Peoples, Robert W; McLaughlin, Joseph S; Zhang, Li (November 2003). "Dynorphin A inhibits NMDA receptors through a pH-dependent mechanism". Molecular and Cellular Neuroscience. 24 (3): 525–537. doi:10.1016/S1044-7431(03)00214-8. PMID 14664805.
Vanderah, Todd W.; Gardell, Luis R.; Burgess, Shannon E.; Ibrahim, Mohab; Dogrul, Ahmet; Zhong, Cheng-Min; Zhang, En-Tan; Malan, T. Philip; Ossipov, Michael H.; Lai, Josephine; Porreca, Frank (2000-09-15). "Dynorphin Promotes Abnormal Pain and Spinal Opioid Antinociceptive Tolerance". The Journal of Neuroscience. 20 (18): 7074–7079. doi:10.1523/JNEUROSCI.20-18-07074.2000. ISSN 0270-6474. PMC 6772839. PMID 10995854.
Bruchas, M.R.; Land, B.B.; Chavkin, C. (February 2010). "The dynorphin/kappa opioid system as a modulator of stress-induced and pro-addictive behaviors". Brain Research. 1314: 44–55. doi:10.1016/j.brainres.2009.08.062. PMC 2819621. PMID 19716811.

ncbi.nlm.nih.gov

Vanderah, Todd W.; Gardell, Luis R.; Burgess, Shannon E.; Ibrahim, Mohab; Dogrul, Ahmet; Zhong, Cheng-Min; Zhang, En-Tan; Malan, T. Philip; Ossipov, Michael H.; Lai, Josephine; Porreca, Frank (2000-09-15). "Dynorphin Promotes Abnormal Pain and Spinal Opioid Antinociceptive Tolerance". The Journal of Neuroscience. 20 (18): 7074–7079. doi:10.1523/JNEUROSCI.20-18-07074.2000. ISSN 0270-6474. PMC 6772839. PMID 10995854.
Bruchas, M.R.; Land, B.B.; Chavkin, C. (February 2010). "The dynorphin/kappa opioid system as a modulator of stress-induced and pro-addictive behaviors". Brain Research. 1314: 44–55. doi:10.1016/j.brainres.2009.08.062. PMC 2819621. PMID 19716811.

semanticscholar.org

api.semanticscholar.org

Tan-No K, Esashi A, Nakagawasai O, et al. (2002). "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. doi:10.1016/S0006-8993(02)03180-3. PMID 12363399. S2CID 1734522.

worldcat.org

search.worldcat.org

Kuzmin, Alexander; Madjid, Nather; Terenius, Lars; Ogren, Sven Ove; Bakalkin, Georgy (2005). "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology. 31 (9): 1928–1937. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
Lai, Josephine; Luo, Miaw-Chyi; Chen, Qingmin; Ma, Shouwu; Gardell, Luis R.; Ossipov, Michael H.; Porreca, Frank (1982-01-22). "Dynorphin A activates bradykinin receptors to maintain neuropathic pain". Nature Neuroscience. 9 (12): 1534–1540. doi:10.1038/nn1804. ISSN 1546-1726. PMID 17115041.
Vanderah, Todd W.; Gardell, Luis R.; Burgess, Shannon E.; Ibrahim, Mohab; Dogrul, Ahmet; Zhong, Cheng-Min; Zhang, En-Tan; Malan, T. Philip; Ossipov, Michael H.; Lai, Josephine; Porreca, Frank (2000-09-15). "Dynorphin Promotes Abnormal Pain and Spinal Opioid Antinociceptive Tolerance". The Journal of Neuroscience. 20 (18): 7074–7079. doi:10.1523/JNEUROSCI.20-18-07074.2000. ISSN 0270-6474. PMC 6772839. PMID 10995854.